PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.105330.1
Common NameCsa_7G432650, LOC101222692
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 549aa    MW: 61287.8 Da    PI: 5.9778
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.105330.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.7e-103684051954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+ +LA+++gLt +qV +WF N R +
  Cucsa.105330.1 368 FEHflHPYPKDSEKLKLARQTGLTRNQVANWFINARVR 405
                     664459******************************88 PP

2BELL96.62.1e-31232303172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erq+l++k +kLlsll eVd+rYkqy++qlq+++ssF++vag g+a+ Ytsl  ++iS hFr L+dai  qi
  Cucsa.105330.1 232 ERQDLKNKNSKLLSLLGEVDRRYKQYYQQLQMLASSFDMVAGRGAAEFYTSLPHQTISCHFRRLQDAINAQI 303
                     799******************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-31150301IPR006563POX domain
PfamPF075264.6E-37157299IPR006563POX domain
PROSITE profilePS5007112.438346409IPR001356Homeobox domain
CDDcd000867.31E-13349410No hitNo description
SMARTSM003891.5E-9349413IPR001356Homeobox domain
SuperFamilySSF466893.46E-17350416IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-27352415IPR009057Homeodomain-like
PfamPF059208.9E-17366405IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MTYFPGLSNQ RDSMLGDHKL GSSCQEQQPL CSGNLMMFMN QDPSCRDYSE ILSGVSSNYV  60
ETVGDRSNVE MAFIPPVVGI LDESNFQCQG VSLSLSTHSP SVVSMSSFPH QYQTPAMVSS  120
FINAPPSILE KRQNPKPCIS DVKNGMYVAL GSGYSMLNSV YIEAAQQLLD EMVSIREALK  180
ELKSKKLKAS NGLGVDSCRE NDGGSNDLTG EMCGNAREAS IANPLSDLSP SERQDLKNKN  240
SKLLSLLGEV DRRYKQYYQQ LQMLASSFDM VAGRGAAEFY TSLPHQTISC HFRRLQDAIN  300
AQIEVTRRAL GEQDSLHSGQ EGIPRLRFVD QHLRQQRALQ HLGVTPHSWR PQRGLPESSV  360
SILRAWLFEH FLHPYPKDSE KLKLARQTGL TRNQVANWFI NARVRLWKPM VEEMYKEEFG  420
DSNIDIKSSP ENASKASWNN SLFSEDRGGD ELHDSTKSVA NNGERVLYRQ CATDDMINSS  480
NFTMGGGDVS LALELKHCEG DEFGMFGNNN NRMVGSVELE GQDFPCLEPE RHHQCRLTSS  540
NMLHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17355412158Homeobox protein Meis1
4xrs_B5e-17355412158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818040.0LN681804.1 Cucumis melo genomic scaffold, anchoredscaffold00060.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004136085.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9FWS91e-106BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A0A0K7050.0A0A0A0K705_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21463179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-88BEL1-like homeodomain 6
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]